H00079854-B01P NCRNA00115 antibody

See related secondary antibodies

Search for all "NCRNA00115"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NCRNA00115

H00079854-B01P

Product Description for NCRNA00115

Mouse anti Human NCRNA00115.
Product is tested for Western blot / Immunoblot.

Properties for NCRNA00115

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ22639
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
NCRNA00115 (AAH17762.1, 1 a.a. ~ 163 a.a) full-length human protein.
AA Sequence:
MWLVFHRPHPRPSWPLRAALGFGRRQSSLRCFPVLPSARPYVSANPTLRGGRLRQDPESETGVGDLPDPVTTLVLL HNRLPLAVTVGCLPSRCPTEKRALPWQGLLHCLAVDVEVGQESEEKTERREVEPTSEKRGGKFRWEVDGSEEFEQT PTVKESDLSKQ
GeneID:
79854
Add. information Mouse polyclonal antibody raised against a full-length human NCRNA00115 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn