H00025915-B01P NDUFAF3 antibody

See related secondary antibodies

Search for all "NDUFAF3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NDUFAF3

H00025915-B01P

Product Description for NDUFAF3

Mouse anti Human NDUFAF3.
Product is tested for Western blot / Immunoblot.

Properties for NDUFAF3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms 2P1, DKFZp564J0123, E3-3, MGC10527
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BU61
Immunogen:
NDUFAF3 (ADZ15813.1, 1 a.a. ~ 184 a.a) full-length human protein.
AA Sequence:
MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGNRVL GPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACAT FNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
GeneID:
25915
Add. information Mouse polyclonal antibody raised against a full-length human NDUFAF3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for NDUFAF3 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 3 open reading frame 60 (C3orf60), transcript variant 1 (transcript variant 1)

Chromosome 3 open reading frame 60 (C3orf60), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for NDUFAF3 (1 products)

Catalog No. Species Pres. Purity   Source  

NDUFAF3 Lysate

Western Blot: NDUFAF3 Lysate [NBL1-08454] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for NDUFAF3. Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn