
NBP1-55278 NEDD4 antibody

See related secondary antibodies

Search for all "NEDD4"

Quick Overview

Rabbit anti Human NEDD4

Product Description for NEDD4

Rabbit anti Human NEDD4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NEDD4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NEDD4(neural precursor cell expressed, developmentally down-regulated 4) The peptide sequence was selected from the middle region of NEDD4. Peptide sequence SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDH
Background NEDD4 is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4 is involved in the budding of many viruses.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn