TA330788 NEMP1 antibody

Rabbit Polyclonal Anti-TMEM194A Antibody

See related secondary antibodies

Search for all "NEMP1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NEMP1

Product Description for NEMP1

Rabbit anti Human NEMP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NEMP1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA0286, Nuclear envelope integral membrane protein 1, TMEM194, TMEM194A
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-TMEM194A antibody is: synthetic peptide directed towards the N-terminal region of Human TMEM194A. Synthetic peptide located within the following region: LSGCLVYGTAETDVNVVMLQESQVCEKRASQQFCYTNVLIPKWHDIWTRI.
Application WB
Background The function of this protein remains unknown.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for NEMP1 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM194A overexpression lysate

TMEM194A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn