
NBP1-55327 NET1 antibody

See related secondary antibodies

Search for all "NET1"

Quick Overview

Rabbit anti Human NET1

Product Description for NET1

Rabbit anti Human NET1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NET1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ARHGEF8, NET1A
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NET1(neuroepithelial cell transforming gene 1) The peptide sequence was selected from the N terminal of NET1. Peptide sequence RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR.
Background NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 10276

Accessory Products

  • LinkedIn