NBP1-56703 NEU4 antibody

See related secondary antibodies

Search for all "NEU4"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse NEU4

Product Description for NEU4

Rabbit anti Human, Mouse NEU4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NEU4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC102757, MGC18222
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3KR05
Immunogen:
Synthetic peptides corresponding to NEU4(sialidase 4) The peptide sequence was selected from the N terminal of NEU4. Peptide sequence TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE.
Background NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn