discontinued

NBP1-56703 NEU4 antibody

See related secondary antibodies

Search for all "NEU4"

Quick Overview

Rabbit anti Human, Mouse NEU4

Product Description for NEU4

Rabbit anti Human, Mouse NEU4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NEU4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC102757, MGC18222
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3KR05
Immunogen:
Synthetic peptides corresponding to NEU4(sialidase 4) The peptide sequence was selected from the N terminal of NEU4. Peptide sequence TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE.
Background NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn