discontinued

H00003084-D01P Neuregulin 1 antibody

See related secondary antibodies

Search for all "Neuregulin 1"

Quick Overview

Rabbit anti Human Neuregulin 1

H00003084-D01P

More Views

  • H00003084-D01P

Product Description for Neuregulin 1

Rabbit anti Human Neuregulin 1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Neuregulin 1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Acetylcholine receptor-inducing activity, Breast cancer cell differentiation factor p45, GGF, Glial growth factor, HGL, HRG, HRGA, Heregulin, NDF, NRG1, Neu differentiation factor, Pro-neuregulin-1 membrane-bound isoform, SMDF, Sensory and motor neuron-derived factor
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02297
Immunogen:
NRG1 (NP_039252.1, 1 a.a. ~ 241 a.a) full-length human protein.
AA Sequence:
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPQLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNE LNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSES PIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMAS FYSTSTPFLSLPE
GeneID:
3084
Remarks:
Gene Accession: NM_013958.1
Add. information Rabbit polyclonal antibody raised against a full-length human NRG1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3084

Accessory Products

Proteins and/or Positive Controls

Proteins for Neuregulin 1 (13 products)

Catalog No. Species Pres. Purity   Source  

Neuregulin 1 (transcript variant GGF2)

Neuregulin 1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €139.00
  OriGene Technologies, Inc.

Neuregulin 1 (beta-1 Isoform)

Neuregulin 1 Human Purified > 98 % > 98 % by SDS-PAGE gel and HPLC analyses E. coli
  OriGene Technologies GmbH

Neuregulin 1 (beta-1 Isoform)

Neuregulin 1 Human Purified > 98 % > 98 % by SDS-PAGE gel and HPLC analyses E. coli
  OriGene Technologies GmbH

Neuregulin 1

Neuregulin 1 Human Purified
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human Purified
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

 Heregulin-B2 structure and sequence Human Purified > 95 % E. coli
10 µg / €310.00
  Neuromics Antibodies

Neuregulin 1

 Heregulin-B2 structure and sequence Human Purified > 95 % E. coli
50 µg / €440.00
  Neuromics Antibodies

Neuregulin 1

Functional Assay: Neuregulin 1 Protein [NBC1-21353] - The bioactivity was determined by dose-dependent cell proliferation assay for MCF-7 cells. ED50 for this NovActive™ NRG1 LOT lies in the range of 0.9-1.3 ng/ml. Affinity purified
  Novus Biologicals Inc.

Neuregulin 1

Neuregulin 1 Affinity purified
  Novus Biologicals Inc.

Neuregulin 1

Neuregulin 1 Affinity purified
  Novus Biologicals Inc.

Positive controls for Neuregulin 1 (4 products)

Catalog No. Species Pres. Purity   Source  

NRG1 293T Cell Transient Overexpression Lysate(Denatured)

NRG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NRG1 293T Cell Transient Overexpression Lysate(Denatured)

NRG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NRG1 Lysate

Western Blot: NRG1 Lysate [NBL1-13790] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NRG1
  Novus Biologicals Inc.

NRG1 overexpression lysate

NRG1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn