TA341925 Neuregulin 1 antibody

Rabbit Polyclonal Anti-NRG1 Antibody

See related secondary antibodies

Search for all "Neuregulin 1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human Neuregulin 1

Product Description for Neuregulin 1

Rabbit anti Bovine, Guinea Pig, Human Neuregulin 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Neuregulin 1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Acetylcholine receptor-inducing activity, Breast cancer cell differentiation factor p45, GGF, Glial growth factor, HGL, HRG, HRGA, Heregulin, NDF, NRG1, Neu differentiation factor, Pro-neuregulin-1 membrane-bound isoform, SMDF, Sensory and motor neuron-derived factor
Presentation Purified
Reactivity Bov, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptide directed towards the middle region of human NRG1. Synthetic peptide located within the following region: SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV.
Application WB
Background The protein encoded byThis gene is a membrane glycoprotein that that mediates cell-cell sigling and plays a critical role inThe growth and development of multiple organ systems. An extraordiry variety of different isoforms are produced fromThis gene through altertive promoter usage and splicing.These isoforms are expressed in a tissue-specific manner and differ significantly inTheir structure, and are classified as types I, II, III, IV, V and VI. Dysregulation ofThis gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Jun 2014].
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Neuregulin 1 (13 products)

Catalog No. Species Pres. Purity   Source  

Neuregulin 1 (transcript variant GGF2)

Neuregulin 1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €230.00
  OriGene Technologies, Inc.

Neuregulin 1 (beta-1 Isoform)

Neuregulin 1 Human Purified > 98 % > 98 % by SDS-PAGE gel and HPLC analyses E. coli
  OriGene Technologies GmbH

Neuregulin 1 (beta-1 Isoform)

Neuregulin 1 Human Purified > 98 % > 98 % by SDS-PAGE gel and HPLC analyses E. coli
  OriGene Technologies GmbH

Neuregulin 1

Neuregulin 1 Human Purified
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human Purified
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

 Heregulin-B2 structure and sequence Human Purified > 95 % E. coli
10 µg / €310.00
  Neuromics Antibodies

Neuregulin 1

 Heregulin-B2 structure and sequence Human Purified > 95 % E. coli
50 µg / €440.00
  Neuromics Antibodies

Neuregulin 1

Functional Assay: Neuregulin 1 Protein [NBC1-21353] - The bioactivity was determined by dose-dependent cell proliferation assay for MCF-7 cells. ED50 for this NovActive™ NRG1 LOT lies in the range of 0.9-1.3 ng/ml. Affinity purified
  Novus Biologicals Inc.

Neuregulin 1

Neuregulin 1 Affinity purified
  Novus Biologicals Inc.

Neuregulin 1

Neuregulin 1 Affinity purified
  Novus Biologicals Inc.

Positive controls for Neuregulin 1 (4 products)

Catalog No. Species Pres. Purity   Source  

NRG1 293T Cell Transient Overexpression Lysate(Denatured)

NRG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NRG1 293T Cell Transient Overexpression Lysate(Denatured)

NRG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NRG1 Lysate

Western Blot: NRG1 Lysate [NBL1-13790] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NRG1
  Novus Biologicals Inc.

NRG1 overexpression lysate

NRG1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn