discontinued

NBP1-93574 NEURL4 antibody

See related secondary antibodies

Search for all "NEURL4"

Quick Overview

Rabbit anti Human NEURL4

Product Description for NEURL4

Rabbit anti Human NEURL4.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for NEURL4

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JN8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: CVQVSITNATGPMDNSLATSNTATEKSFPLHSPVAGVAHRFHSTCGKNVTLEEDGTRAVRAAGYAHGLVFSTKELRAEEVFEVKVEELDEKWAGS
GeneID:
84461
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84461

Accessory Products

Proteins and/or Positive Controls

Positive controls for NEURL4 (1 products)

Catalog No. Species Pres. Purity   Source  

NEURL4 overexpression lysate

NEURL4 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn