discontinued

H00004760-M02 NEUROD1 antibody

See related secondary antibodies

Search for all "NEUROD1"

Quick Overview

Mouse anti Human NEUROD1 3D11

H00004760-M02

More Views

  • H00004760-M02
  • H00004760-M02

Product Description for NEUROD1

Mouse anti Human NEUROD1 3D11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for NEUROD1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms NEUROD, NEUROD1, Neurogenic differentiation factor 1
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 3D11
Host Mouse
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13562
Immunogen:
NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPP LSINGNFSFKHEPSAEFEKNYAFT
GeneID:
4760
Remarks:
Gene Accession: BC009046
Add. information Mouse monoclonal antibody raised against a partial recombinant NEUROD1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4760

Accessory Products

Proteins and/or Positive Controls

Proteins for NEUROD1 (8 products)

Catalog No. Species Pres. Purity   Source  

NEUROD1

NEUROD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

NEUROD1

NEUROD1 Human
  Abnova Taiwan Corp.

NEUROD1

NEUROD1 Human Purified
  Abnova Taiwan Corp.

NEUROD1

NEUROD1 Human Purified
  Abnova Taiwan Corp.

NEUROD1

NEUROD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NEUROD1

NEUROD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NEUROD1

NEUROD1 Human
  Abnova Taiwan Corp.

NEUROD1

NEUROD1 Human
  Abnova Taiwan Corp.

Positive controls for NEUROD1 (3 products)

Catalog No. Species Pres. Purity   Source  

NEUROD1 293T Cell Transient Overexpression Lysate(Denatured)

NEUROD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NeuroD1 Lysate

Western Blot: NeuroD1 Lysate [NBL1-13598] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NEUROD1
  Novus Biologicals Inc.

NEUROD1 overexpression lysate

NEUROD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn