TA329757 NEUROD1 antibody

Rabbit Polyclonal Anti-NEUROD1 Antibody

See related secondary antibodies

Search for all "NEUROD1"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NEUROD1

Product Description for NEUROD1

Rabbit anti Human NEUROD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NEUROD1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms NEUROD, NEUROD1, Neurogenic differentiation factor 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-NEUROD1 antibody: synthetic peptide directed towards the N terminal of human NEUROD1. Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE.
Application WB
Background NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for NEUROD1 (8 products)

Catalog No. Species Pres. Purity   Source  


NEUROD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.


  Abnova Taiwan Corp.


NEUROD1 Human Purified
  Abnova Taiwan Corp.


NEUROD1 Human Purified
  Abnova Taiwan Corp.


NEUROD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


NEUROD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


  Abnova Taiwan Corp.


  Abnova Taiwan Corp.

Positive controls for NEUROD1 (3 products)

Catalog No. Species Pres. Purity   Source  

NEUROD1 293T Cell Transient Overexpression Lysate(Denatured)

NEUROD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NeuroD1 Lysate

Western Blot: NeuroD1 Lysate [NBL1-13598] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NEUROD1
  Novus Biologicals Inc.

NEUROD1 overexpression lysate

NEUROD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn