TA343302 Neuropeptide B antibody

Rabbit Polyclonal Anti-NPB Antibody

See related secondary antibodies

Search for all "Neuropeptide B"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Rat Neuropeptide B

Product Description for Neuropeptide B

Rabbit anti Bovine, Canine, Human, Rat Neuropeptide B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Neuropeptide B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms NPB, PPL7, PPNPB
Presentation Purified
Reactivity Bov, Can, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-NPB antibody is: synthetic peptide directed towards the C-terminal region of NPB. Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV.
Application WB
Background Neuropeptide B (NPB) is an endogenous peptide ligand for G protein-coupled receptor-7.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1062% sucrose.

Accessory Products

  • LinkedIn