
NBP1-69215 NFAT2 antibody

See related secondary antibodies

Search for all "NFAT2"

50 µg / €440.00

Quick Overview

Rabbit anti Human NFAT2


Product Description for NFAT2

Rabbit anti Human NFAT2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NFAT2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC138448, NF-ATC, NFAT2, NFATc
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NFATC1 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1) The peptide sequence was selected from the C terminal of NFATC1. Peptide sequence LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEI
Background NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 4772

Accessory Products

  • LinkedIn