NBP1-69215 NFAT2 antibody

See related secondary antibodies

Search for all "NFAT2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NFAT2


Product Description for NFAT2

Rabbit anti Human NFAT2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NFAT2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC138448, NF-ATC, NFAT2, NFATc
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NFATC1 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1) The peptide sequence was selected from the C terminal of NFATC1. Peptide sequence LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEI
Background NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 4772

Accessory Products

  • LinkedIn