TA343495 NFKBIL1 antibody

Rabbit Polyclonal Anti-NFKBIL1 Antibody

See related secondary antibodies

Search for all "NFKBIL1"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat NFKBIL1

Product Description for NFKBIL1

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat NFKBIL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NFKBIL1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms I-kappa-B-like protein, IKBL, IkappaBL, Inhibitor of kappa B-like protein, NF-kappa-B inhibitor-like protein 1, Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBC1
Immunogen:
The immunogen for anti-NFKBIL1 antibody: synthetic peptide directed towards the N terminal of human NFKBIL1. Synthetic peptide located within the following region: MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQ.
GeneID:
4795
Application WB
Background NFKBIL1 is a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isofor
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NFKBIL1 (1 products)

Catalog No. Species Pres. Purity   Source  

NFKBIL1 (transcript variant 1)

NFKBIL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for NFKBIL1 (1 products)

Catalog No. Species Pres. Purity   Source  

NFKBIL1 overexpression lysate

NFKBIL1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn