NBP1-59888 NHE8 antibody

See related secondary antibodies

Search for all "NHE8"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat NHE8

Product Description for NHE8

Rabbit anti Human, Mouse, Rat NHE8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NHE8

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp686C03237, FLJ42500, KIAA0939, MGC138418, NHE8
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SLC9A8(solute carrier family 9 (sodium/hydrogen exchanger), member 8) The peptide sequence was selected from the middle region of SLC9A8. Peptide sequence AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQE
Background Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23315

Accessory Products

  • LinkedIn