discontinued

NBP1-59888 NHE8 antibody

See related secondary antibodies

Search for all "NHE8"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat NHE8

Product Description for NHE8

Rabbit anti Human, Mouse, Rat NHE8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NHE8

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp686C03237, FLJ42500, KIAA0939, MGC138418, NHE8
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2M1U9
Immunogen:
Synthetic peptides corresponding to SLC9A8(solute carrier family 9 (sodium/hydrogen exchanger), member 8) The peptide sequence was selected from the middle region of SLC9A8. Peptide sequence AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQE
GeneID:
23315
Background Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 23315

Accessory Products

  • LinkedIn