H00286183-B01P NKAIN3 antibody

See related secondary antibodies

Search for all "NKAIN3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NKAIN3

H00286183-B01P

Product Description for NKAIN3

Mouse anti Human NKAIN3.
Product is tested for Western blot / Immunoblot.

Properties for NKAIN3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FAM77D, FLJ39630
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N8D7
Immunogen:
NKAIN3 (AAI46367.1, 1 a.a. ~ 197 a.a) full-length human protein.
AA Sequence:
MGCCTGRCSLICLCALQLVSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIMVYTVWTALWVTWN VFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEVIHSAV QILLSLVGFVYACYVISISMEEEDTYSCDLQVCKHLFIQMLQIIE
GeneID:
286183
Add. information Mouse polyclonal antibody raised against a full-length human NKAIN3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn