H00408050-M03 NOMO3 antibody

See related secondary antibodies

Search for all "NOMO3"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NOMO3 5A7

H00408050-M03

Product Description for NOMO3

Mouse anti Human NOMO3 5A7.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for NOMO3

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Nomo
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 5A7
Host Mouse
Isotype IgG2a
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P69849
Immunogen:
NOMO3 (NP_001004067.1, 966 a.a. ~ 1033 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH
GeneID:
408050
Add. information Mouse monoclonal antibody raised against a partial recombinant NOMO3.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

Proteins and/or Positive Controls

Proteins for NOMO3 (1 products)

Catalog No. Species Pres. Purity   Source  

NODAL modulator 3 (NOMO3)

NODAL modulator 3 (NOMO3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn