H00152519-B01P NPAL1 antibody

See related secondary antibodies

Search for all "NPAL1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NPAL1

H00152519-B01P

Product Description for NPAL1

Mouse anti Human NPAL1.
Product is tested for Western blot / Immunoblot.

Properties for NPAL1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp686A06115
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NVV3
Immunogen:
NPAL1 (NP_997213.1, 1 a.a. ~ 410 a.a) full-length human protein.
AA Sequence:
MGAQVRLPPGEPCREGYVLSLVCPNSSQAWCEITNVSQLLASPVLYTDLNYSINNLSISANVENKYSLYVGLVLAV SSSIFIGSSFILKKKGLLQLASKGFTRAGQGGHSYLKEWLWWVGLLSMGAGEAANFAAYAFAPATLVTPLGALSVL ISAILSSYFLNEHLNIHGKIGCILSILGSTVMVIHAPQEEEVTSLHEMEMKLRDPGFISFAVIITVISLVLILIVA PKKGQTNILVYISICSLIGAFSVSSVKGLGIAIKELIEWKPVYKHPLVFVLLAVLVLSVTTQINYLNKALDTFNTS LVTPIYYVFFTSMVVTCSAILFQEWYGMTAGDIIGTLSGFFTIIIGIFLLHAFKNTDITWSELTSTAKKEAVSLNV NENNYVLLENLECSAPGYNDDVTLFSRTDD
GeneID:
152519
Add. information Mouse polyclonal antibody raised against a full-length human NPAL1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn