F-MKA0673AF NPHP4 (KIAA0673) antibody

See related secondary antibodies

Search for all "NPHP4 (KIAA0673)"

50 µg / €680.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse NPHP4 (KIAA0673)

F-MKA0673AF

Product Description for NPHP4 (KIAA0673)

Rabbit anti Mouse NPHP4 (KIAA0673).
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NPHP4 (KIAA0673)

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Germany only
PDF datasheet View Datasheet
Manufacturer Funakoshi Co., Ltd.

Datasheet Extract

Immunogen
Swiss Prot Num:
P59240
Immunogen:
GX1797 (GST-fusion protein, 176 amino acids)VLRGTQTVRKVRAFTSHPQELKTDPAGVFVLPPHGVQDLHVGVRPRRAGSRFVHLNLVDIDYHQLVASWLVCLSCRQPLISKAFEITMAAGDEKGTNKRITYTNPYPSRRTYRLHSDRPELLRFKEDSFQVAGGETYTIGLRFLPSGSAGQEEILIYINDHEDKNEETFCVKVLYQ.
GeneID:
260305
Add. information Shipping conditions: Dry Ice
Storage -20℃
Format
State:
Aff - Purified

Accessory Products

  • LinkedIn