H00064111-B01P NPVF antibody

See related secondary antibodies

Search for all "NPVF"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human NPVF

H00064111-B01P

Product Description for NPVF

Mouse anti Human NPVF.
Product is tested for Western blot / Immunoblot.

Properties for NPVF

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C7orf9, RFRP
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCQ7
Immunogen:
NPVF (AAI60068.1, 1 a.a. ~ 196 a.a) full-length human protein.
AA Sequence:
MEIISSKLFILLTLATSSLLTSNIFCADELVMSNLHSKENYDKYSEPRGYPKGERSLNFEELKDWGPKNVIKMSTP AVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSM HSPCANDLFYSMTCQHQEIQNPDQKQSRRLLFKKIDDAELKQEK
GeneID:
64111
Add. information Mouse polyclonal antibody raised against a full-length human NPVF protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for NPVF (1 products)

Catalog No. Species Pres. Purity   Source  

NPVF overexpression lysate

NPVF overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn