NBP1-86724 NPVF antibody

See related secondary antibodies

Search for all "NPVF"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NPVF

NBP1-86724

More Views

  • NBP1-86724

Product Description for NPVF

Rabbit anti Human NPVF.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NPVF

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCQ7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQ
GeneID:
64111
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 64111

Accessory Products

Proteins and/or Positive Controls

Positive controls for NPVF (1 products)

Catalog No. Species Pres. Purity   Source  

NPVF overexpression lysate

NPVF overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn