TA332017 NR1H2 antibody

Rabbit Polyclonal Anti-Nr1h2 Antibody

See related secondary antibodies

Search for all "NR1H2"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NR1H2

Product Description for NR1H2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NR1H2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NR1H2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms LXRB, Liver X receptor beta, NER, Nuclear orphan receptor LXR-beta, Nuclear receptor NER, Nuclear receptor subfamily 1 group H member 2, Oxysterols receptor LXR-beta, UNR, Ubiquitously-expressed nuclear receptor
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55055
Immunogen:
The immunogen for Anti-Nr1h2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Nr1h2. Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL.
GeneID:
7376
Application WB
Background Nr1h2 is a nuclear orphan receptor; It may be involved in modulating 9-cis-retinoic acid sigling by interacting with retinoic acid receptor (RXR).
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NR1H2 (3 products)

Catalog No. Species Pres. Purity   Source  

NR1H2

NR1H2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

NR1H2

NR1H2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NR1H2

NR1H2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn