discontinued

H00007101-M06 NR2E1 antibody

See related secondary antibodies

Search for all "NR2E1"

Quick Overview

Mouse anti Human NR2E1 4D2

Product Description for NR2E1

Mouse anti Human NR2E1 4D2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence.

Properties for NR2E1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Nuclear receptor TLX, Nuclear receptor subfamily 2 group E member 1, Protein tailless homolog, TLX
Presentation Purified
Reactivity Hu
Applications E, ICC/IF
Clonality Monoclonal
Clone 4D2
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y466
Immunogen:
NR2E1 (NP_003260, 249 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLT LNSYIHTRYPTQPCRFGK*
GeneID:
7101
Remarks:
Gene Accession: NM_003269
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant NR2E1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7101

Accessory Products

Proteins and/or Positive Controls

Proteins for NR2E1 (5 products)

Catalog No. Species Pres. Purity   Source  

NR2E1

NR2E1 Human Purified
  Abnova Taiwan Corp.

NR2E1

NR2E1 Human
  Abnova Taiwan Corp.

NR2E1

NR2E1 Human Purified
  Abnova Taiwan Corp.

NR2E1

NR2E1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NR2E1

NR2E1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NR2E1 (1 products)

Catalog No. Species Pres. Purity   Source  

NR2E1 293T Cell Transient Overexpression Lysate(Denatured)

NR2E1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn