TA339740 NRIP3 antibody

Rabbit Polyclonal Anti-NRIP3 Antibody

See related secondary antibodies

Search for all "NRIP3"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NRIP3

Product Description for NRIP3

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NRIP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NRIP3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Nuclear receptor interacting protein 3
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-NRIP3 antibody: synthetic peptide directed towards the middle region of human NRIP3. Synthetic peptide located within the following region: EKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSE.
Application WB
Background The exact functions of NRIP3 remain unknown.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for NRIP3 (5 products)

Catalog No. Species Pres. Purity   Source  


NRIP3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NRIP3 (1-241, His-tag)

NRIP3 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

NRIP3 (1-241, His-tag)

NRIP3 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH


NRIP3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


NRIP3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NRIP3 (2 products)

Catalog No. Species Pres. Purity   Source  

NRIP3 Lysate

Western Blot: NRIP3 Lysate [NBL1-13794] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NRIP3
  Novus Biologicals Inc.

NRIP3 overexpression lysate

NRIP3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn