discontinued

NBP1-56911 NT5C1B antibody

See related secondary antibodies

Search for all "NT5C1B"

Quick Overview

Rabbit anti Human NT5C1B

Product Description for NT5C1B

Rabbit anti Human NT5C1B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NT5C1B

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B7ZVX7
Immunogen:
Synthetic peptides corresponding to NT5C1B(5'-nucleotidase, cytosolic IB) The peptide sequence was selected from the N terminal of NT5C1B. Peptide sequence MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT.
GeneID:
100526794
Background Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 93034

Accessory Products

  • LinkedIn