NBP1-56911 NT5C1B antibody

See related secondary antibodies

Search for all "NT5C1B"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NT5C1B

Product Description for NT5C1B

Rabbit anti Human NT5C1B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NT5C1B

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B7ZVX7
Immunogen:
Synthetic peptides corresponding to NT5C1B(5'-nucleotidase, cytosolic IB) The peptide sequence was selected from the N terminal of NT5C1B. Peptide sequence MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT.
GeneID:
100526794
Background Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 93034

Accessory Products

  • LinkedIn