discontinued

NBP1-56365 NUDCD3 antibody

See related secondary antibodies

Search for all "NUDCD3"

50 µg / €390.00

Quick Overview

Rabbit anti Human NUDCD3

Product Description for NUDCD3

Rabbit anti Human NUDCD3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NUDCD3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA1068, NudCL
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5RB75
Immunogen:
Synthetic peptides corresponding to NUDCD3(NudC domain containing 3) The peptide sequence was selected from the middle region of NUDCD3. Peptide sequence KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD.
GeneID:
100174424
Background The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 100174424

Accessory Products

  • LinkedIn