discontinued

H00083594-B01 NUDT12 antibody

See related secondary antibodies

Search for all "NUDT12"

Quick Overview

Mouse anti Human NUDT12

H00083594-B01

More Views

  • H00083594-B01

Product Description for NUDT12

Mouse anti Human NUDT12.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for NUDT12

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Nucleoside diphosphate-linked moiety X motif 12, Nudix motif 12, Peroxisomal NADH pyrophosphatase NUDT12
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BQG2
Immunogen:
NUDT12 (NP_113626.1, 1 a.a. ~ 462 a.a) full-length human protein.
AA Sequence:
MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPEIVQFLLEKGCDRSIVN KSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLLAKESHPATVFIL FSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPREEEDGLVAWF ALGIDPIAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKRLCLK EDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVKVG HVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWI RINPNL
GeneID:
83594
Remarks:
Gene Accession: NM_031438.2
Add. information Mouse polyclonal antibody raised against a full-length human NUDT12 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 83594

Accessory Products

Proteins and/or Positive Controls

Proteins for NUDT12 (3 products)

Catalog No. Species Pres. Purity   Source  

NUDT12

NUDT12 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

NUDT12

NUDT12 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NUDT12

NUDT12 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NUDT12 (2 products)

Catalog No. Species Pres. Purity   Source  

NUDT12 293T Cell Transient Overexpression Lysate(Denatured)

NUDT12 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NUDT12 Lysate

Western Blot: NUDT12 Lysate [NBL1-13855] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NUDT12
  Novus Biologicals Inc.
  • LinkedIn