discontinued

H00053343-B01P NUDT9 / NUDT10 antibody

See related secondary antibodies

Search for all "NUDT9 / NUDT10"

Quick Overview

Mouse anti Human NUDT9 / NUDT10

H00053343-B01P

More Views

  • H00053343-B01P
  • H00053343-B01P
  • H00053343-B01P

Product Description for NUDT9 / NUDT10

Mouse anti Human NUDT9 / NUDT10.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for NUDT9 / NUDT10

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ADP-ribose diphosphatase, ADP-ribose phosphohydrolase, ADP-ribose pyrophosphatase, ADPR-PPase, Adenosine diphosphoribose pyrophosphatase, Nucleoside diphosphate-linked moiety X motif 9, Nudix motif 9
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BW91
Immunogen:
NUDT9 (NP_076952.1, 1 a.a. ~ 350 a.a) full-length human protein.
AA Sequence:
MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPYPGSKVE RSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLYEIENGRPRNPAG RTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLK REFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLMLEAGD DAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL
GeneID:
53343
Remarks:
Gene Accession: NM_024047.3
Add. information Mouse polyclonal antibody raised against a full-length human NUDT9 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 53343

Accessory Products

Proteins and/or Positive Controls

Proteins for NUDT9 / NUDT10 (8 products)

Catalog No. Species Pres. Purity   Source  

NUDT9 / NUDT10 (transcript variant 3)

NUDT9 / NUDT10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NUDT9 / NUDT10 (transcript variant 1)

NUDT9 / NUDT10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NUDT9 / NUDT10 (47-350, His-tag)

NUDT9 / NUDT10 Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

NUDT9 / NUDT10 (47-350, His-tag)

NUDT9 / NUDT10 Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

NUDT9 / NUDT10

NUDT9 / NUDT10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NUDT9 / NUDT10

NUDT9 / NUDT10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NUDT9 / NUDT10

NUDT9 / NUDT10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NUDT9 / NUDT10

NUDT9 / NUDT10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NUDT9 / NUDT10 (3 products)

Catalog No. Species Pres. Purity   Source  

NUDT9 293T Cell Transient Overexpression Lysate(Denatured)

NUDT9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NUDT9 Lysate

Western Blot: NUDT9 Lysate [NBL1-13867] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NUDT9
  Novus Biologicals Inc.

NUDT9 Lysate

Western Blot: NUDT9 Lysate [NBL1-13868] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NUDT9
  Novus Biologicals Inc.
  • LinkedIn