TA339361 NUP37 antibody

Rabbit Polyclonal Anti-Nup37 Antibody

See related secondary antibodies

Search for all "NUP37"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NUP37

Product Description for NUP37

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NUP37.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NUP37

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Nucleoporin Nup37, Nup107-160 subcomplex subunit Nup37, p37
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-Nup37 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EEETDIEGIQYKTLRTFHHGVRVDGIAWSPETKLDSLPPVIKFCTSAADL.
Application WB
Background Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functiol NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn