TA331341 NUP54 antibody

Rabbit Polyclonal Anti-NUP54 Antibody

See related secondary antibodies

Search for all "NUP54"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NUP54

Product Description for NUP54

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NUP54.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NUP54

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 54 kDa nucleoporin, Nucleoporin p54
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-NUP54 antibody is: synthetic peptide directed towards the C-terminal region of Human NUP54. Synthetic peptide located within the following region: AGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRL.
Application WB
Background The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. This gene encodes a member of the phe-gly (FG) repeat-containing nucleoporin subset.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for NUP54 (4 products)

Catalog No. Species Pres. Purity   Source  


NUP54 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


NUP54 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


NUP54 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


NUP54 Human
  Abnova Taiwan Corp.

Positive controls for NUP54 (2 products)

Catalog No. Species Pres. Purity   Source  

NUP54 293T Cell Transient Overexpression Lysate(Denatured)

NUP54 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NUP54 overexpression lysate

NUP54 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn