discontinued

H00004928-B02 NUP98 / ADAR2 antibody

See related secondary antibodies

Search for all "NUP98 / ADAR2"

Quick Overview

Mouse anti Human NUP98 / ADAR2

Product Description for NUP98 / ADAR2

Mouse anti Human NUP98 / ADAR2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for NUP98 / ADAR2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Nuclear pore complex protein Nup98-Nup96
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P52948
Immunogen:
NUP98 (AAH12906, 1 a.a. ~ 606 a.a) full-length human protein.
AA Sequence:
MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELD SQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLS QFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPT ASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSI TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQ LLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYL KGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLA QSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
GeneID:
4928
Remarks:
Gene Accession: BC012906
Add. information Mouse polyclonal antibody raised against a full-length human NUP98 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 4928

Accessory Products

Proteins and/or Positive Controls

Proteins for NUP98 / ADAR2 (4 products)

Catalog No. Species Pres. Purity   Source  

NUP98 / ADAR2

NUP98 / ADAR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NUP98 / ADAR2

NUP98 / ADAR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NUP98 / ADAR2

NUP98 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NUP98 / ADAR2

NUP98 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NUP98 / ADAR2 (1 products)

Catalog No. Species Pres. Purity   Source  

NUP98 293T Cell Transient Overexpression Lysate(Denatured)

NUP98 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn