discontinued

H00004928-D01P NUP98 / ADAR2 antibody

See related secondary antibodies

Search for all "NUP98 / ADAR2"

Quick Overview

Rabbit anti Human NUP98 / ADAR2

Product Description for NUP98 / ADAR2

Rabbit anti Human NUP98 / ADAR2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for NUP98 / ADAR2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Nuclear pore complex protein Nup98-Nup96
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P52948
Immunogen:
NUP98 (AAH12906.1, 1 a.a. ~ 606 a.a) full-length human protein.
AA Sequence:
MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELD SQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLS QFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPT ASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSI TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQ LLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYL KGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLA QSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
GeneID:
4928
Remarks:
Gene Accession: BC012906
Add. information Rabbit polyclonal antibody raised against a full-length human NUP98 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4928

Accessory Products

Proteins and/or Positive Controls

Proteins for NUP98 / ADAR2 (4 products)

Catalog No. Species Pres. Purity   Source  

NUP98 / ADAR2

NUP98 / ADAR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NUP98 / ADAR2

NUP98 / ADAR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NUP98 / ADAR2

NUP98 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NUP98 / ADAR2

NUP98 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NUP98 / ADAR2 (1 products)

Catalog No. Species Pres. Purity   Source  

NUP98 293T Cell Transient Overexpression Lysate(Denatured)

NUP98 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn