discontinued

H00056001-B01P NXF2 antibody

See related secondary antibodies

Search for all "NXF2"

Quick Overview

Mouse anti Human NXF2

Product Description for NXF2

Mouse anti Human NXF2.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for NXF2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Cancer/testis antigen 39, Nuclear RNA export factor 2, TAP-like protein 2, TAPL2
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZY0
Immunogen:
NXF2 (NP_060279.2, 1 a.a. ~ 626 a.a) full-length human protein.
AA Sequence:
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHYEHGGYERPPSHCQENDGSVEMRDVHKDQQL RHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMSQNTQDGYTRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRF TPVDFHYVRNRACFFVQDASAASALKDVSYKIYDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVS QQALDLQNLRFDPDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLS KNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDIDSSETMKPCKE NFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEACFSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLK GELLRRTKRDIVDSLSALPKTQHDLSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSL CIVNDELFVRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWNYTRAGQAF TMLQTEGKIPAEAFKQIS
GeneID:
56001
Remarks:
Gene Accession: NM_017809.3
Add. information Mouse polyclonal antibody raised against a full-length human NXF2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human
Gene ID 56001

Accessory Products

Proteins and/or Positive Controls

Proteins for NXF2 (5 products)

Catalog No. Species Pres. Purity   Source  

NXF2 (full length, N-term HIS tag, transcript variant 2)

NXF2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

NXF2

NXF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NXF2

NXF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NXF2

NXF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NXF2

NXF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NXF2 (4 products)

Catalog No. Species Pres. Purity   Source  

NXF2 293T Cell Transient Overexpression Lysate(Denatured)

NXF2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NXF2B overexpression lysate

NXF2B overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

NXF2 Lysate

Western Blot: NXF2 Lysate [NBL1-13889] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NXF2
  Novus Biologicals Inc.

NXF2 overexpression lysate

NXF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn