discontinued

H00079991-B01P OBFC1 antibody

See related secondary antibodies

Search for all "OBFC1"

Quick Overview

Mouse anti Human OBFC1

H00079991-B01P

More Views

  • H00079991-B01P
  • H00079991-B01P

Product Description for OBFC1

Mouse anti Human OBFC1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for OBFC1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CST complex subunit STN1, Oligonucleotide/oligosaccharide-binding fold-containing protein 1, Suppressor of cdc thirteen homolog
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H668
Immunogen:
OBFC1 (NP_079204.1, 1 a.a. ~ 368 a.a) full-length human protein.
AA Sequence:
MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYG VDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATAY YKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQE LEMVESLLSLANQPVIHSACSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKI HRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF
GeneID:
79991
Remarks:
Gene Accession: NM_024928.3
Add. information Mouse polyclonal antibody raised against a full-length human OBFC1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 79991

Accessory Products

Proteins and/or Positive Controls

Proteins for OBFC1 (5 products)

Catalog No. Species Pres. Purity   Source  

OBFC1

OBFC1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

OBFC1 (1-368, His-tag)

OBFC1 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

OBFC1 (1-368, His-tag)

OBFC1 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH

OBFC1

OBFC1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

OBFC1

OBFC1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for OBFC1 (3 products)

Catalog No. Species Pres. Purity   Source  

OBFC1 293T Cell Transient Overexpression Lysate(Denatured)

OBFC1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

OBFC1 Lysate

Western Blot: OBFC1 Lysate [NBL1-13899] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for OBFC1
  Novus Biologicals Inc.

OBFC1 overexpression lysate

OBFC1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn