H00729330-B01P OC90 antibody

See related secondary antibodies

Search for all "OC90"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human OC90

H00729330-B01P

Product Description for OC90

Mouse anti Human OC90.
Product is tested for Western blot / Immunoblot.

Properties for OC90

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms PLA2L
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02509
Immunogen:
OC90 (AAI60180.1, 1 a.a. ~ 477 a.a) full-length human protein.
AA Sequence:
MAAEDVIICDTLQPCHVAMATDITFFSGMFKNVESVAEIFDCLGPHFTWLQAVFTNFPVLIQFVNGMKCVAGLCPR DFEDYGCTCRFEMEGLPVDESDSCCFQHRRCYEEAAEMDCLQDPAKLSTEVNCVSKKIICESKDNCEHLLCTCDKA AIECLARSSLNSSLNLLDTSFCLAQTPETTIKEDLTTLLPRVVPVEPTDTSLTALSGEVAAETEADRLITLSKKKA GHDQEGVGAARATSPPGSAEIVATRVTAKIVTLVPAGIKSLGLAVSSVENDPEETTEKACDRFTFLHLGSGDNMQV MPQLGEMLFCLTSRCPEEFESYGCYCGQEGRGEPRDDLDRCCLSHHCCLEQVRRLGCLLERLPWSPVVCVDHTPKC GGQSLCEKLLCACDQTAAECMTSASFNQSLKSPSRLGCPGQPAACEDSLHPVPAAPTLGSSSEEDSEEDPPQEDLG RAKRFLRKSLGPLGIGPLHGR
GeneID:
729330
Add. information Mouse polyclonal antibody raised against a full-length human OC90 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for OC90 (1 products)

Catalog No. Species Pres. Purity   Source  

OC90 overexpression lysate

OC90 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn