discontinued

H00004950-M01 Occludin antibody

See related secondary antibodies

Search for all "Occludin"

Quick Overview

Mouse anti Human Occludin 1G7

H00004950-M01

More Views

  • H00004950-M01
  • H00004950-M01

Product Description for Occludin

Mouse anti Human Occludin 1G7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for Occludin

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms OCLN
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 1G7
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16625
Immunogen:
OCLN (NP_002529, 423 a.a. ~ 523 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKN HCKQLKSKLSHIKKMVGDYDRQKT*
GeneID:
100506658
Remarks:
Gene Accession: NM_002538
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant OCLN.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4950

Accessory Products

Proteins and/or Positive Controls

Proteins for Occludin (6 products)

Catalog No. Species Pres. Purity   Source  

Occludin

Occludin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Occludin

Occludin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Occludin

Occludin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Occludin

Occludin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Occludin

Occludin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Occludin

Occludin Human Purified
  Novus Biologicals Inc.

Positive controls for Occludin (3 products)

Catalog No. Species Pres. Purity   Source  

Occludin Lysate

Western Blot: Occludin Lysate [NBL1-13904] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for OCLN
  Novus Biologicals Inc.

OCLN 293T Cell Transient Overexpression Lysate(Denatured)

OCLN 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

OCLN overexpression lysate

OCLN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn