
NBP1-56820 ODF2L antibody

See related secondary antibodies

Search for all "ODF2L"

Quick Overview

Rabbit anti Human, Rat ODF2L

Product Description for ODF2L

Rabbit anti Human, Rat ODF2L.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ODF2L

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ODF2L(outer dense fiber of sperm tails 2-like) The peptide sequence was selected from the N terminal of ODF2L. Peptide sequence KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH.
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 57489

Accessory Products

  • LinkedIn