NBP1-56820 ODF2L antibody

See related secondary antibodies

Search for all "ODF2L"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ODF2L

Product Description for ODF2L

Rabbit anti Human, Rat ODF2L.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ODF2L

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MU56
Immunogen:
Synthetic peptides corresponding to ODF2L(outer dense fiber of sperm tails 2-like) The peptide sequence was selected from the N terminal of ODF2L. Peptide sequence KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH.
GeneID:
57489
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 57489

Accessory Products

  • LinkedIn