TA331499 Olfactory receptor 10A4 antibody

Rabbit Polyclonal Anti-OR10A4 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 10A4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Olfactory receptor 10A4

Product Description for Olfactory receptor 10A4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Olfactory receptor 10A4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 10A4

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms HP2, OR10A4, OR10A4P, Olfactory receptor-like protein JCG5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-OR10A4 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10A4. Synthetic peptide located within the following region: TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR.
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn