TA337500 Olfactory receptor 4A16 antibody

Rabbit Polyclonal Anti-OR4A16 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 4A16"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Porcine Olfactory receptor 4A16

Product Description for Olfactory receptor 4A16

Rabbit anti Human, Porcine Olfactory receptor 4A16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 4A16

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms OR4A16, Olfactory receptor OR11-117
Presentation Purified
Reactivity Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NH70
Immunogen:
The immunogen for Anti-OR4A16 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4A16. Synthetic peptide located within the following region: FLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPV.
GeneID:
81327
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn