TA332291 Olfactory receptor 8H1 antibody

Rabbit Polyclonal Anti-OR8H1 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 8H1"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Yeast Olfactory receptor 8H1

Product Description for Olfactory receptor 8H1

Rabbit anti Human, Yeast Olfactory receptor 8H1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 8H1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms OR8H1, Olfactory receptor OR11-180
Presentation Purified
Reactivity Hu, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NGG4
Immunogen:
The immunogen for Anti-OR8H1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8H1. Synthetic peptide located within the following region: RKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNALIRVMQRRQDSR.
GeneID:
219469
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Olfactory receptor 8H1 (2 products)

Catalog No. Species Pres. Purity   Source  

Olfactory receptor 8H1

Olfactory receptor 8H1 Human Purified
  Abnova Taiwan Corp.

Olfactory receptor 8H1

Olfactory receptor 8H1 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn