TA334340 Olfr872 antibody

See related secondary antibodies

Search for all "Olfr872"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat Olfr872

Product Description for Olfr872

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat Olfr872.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfr872

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
E9PVW2
Immunogen:
The immunogen for anti-Olfr872 antibody is: synthetic peptide directed towards the middle region of Mouse Olfr872. Synthetic peptide located within the following region: RIPTKDGKYKAFSTCGSHLSVVCLFYGTSIGVYIGSTASNSPKNCAIASL.
GeneID:
258553
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn