discontinued

H00010215-B01 OLIG2 antibody

See related secondary antibodies

Search for all "OLIG2"

Quick Overview

Mouse anti Human OLIG2

Product Description for OLIG2

Mouse anti Human OLIG2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for OLIG2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BHLHB1, Class B basic helix-loop-helix protein 1, OLIG2, Oligo2, Oligodendrocyte transcription factor 2, PRKCBP2, Protein kinase C-binding protein 2, Protein kinase C-binding protein RACK17, RACK17, bHLHB1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13516
Immunogen:
OLIG2 (AAH36245.1, 1 a.a. ~ 323 a.a) full-length human protein.
AA Sequence:
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPVDKLGGSGFK SSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATL LLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAA AAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQVPPPH HHVSAMGAGSLPRLTSDAK
GeneID:
10215
Remarks:
Gene Accession: BC036245.1
Add. information Mouse polyclonal antibody raised against a full-length human OLIG2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10215

Accessory Products

Proteins and/or Positive Controls

Proteins for OLIG2 (3 products)

Catalog No. Species Pres. Purity   Source  

OLIG2

OLIG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OLIG2 (1 products)

Catalog No. Species Pres. Purity   Source  

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn