discontinued

H00010215-M03 OLIG2 antibody

See related secondary antibodies

Search for all "OLIG2"

Quick Overview

Mouse anti Human OLIG2 3C9

Product Description for OLIG2

Mouse anti Human OLIG2 3C9.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for OLIG2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BHLHB1, Class B basic helix-loop-helix protein 1, OLIG2, Oligo2, Oligodendrocyte transcription factor 2, PRKCBP2, Protein kinase C-binding protein 2, Protein kinase C-binding protein RACK17, RACK17, bHLHB1
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 3C9
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13516
Immunogen:
OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKS S
GeneID:
10215
Remarks:
Gene Accession: NM_005806
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant OLIG2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10215
FocusOn and Reviews
FocusOns:

Accessory Products

Proteins and/or Positive Controls

Proteins for OLIG2 (3 products)

Catalog No. Species Pres. Purity   Source  

OLIG2

OLIG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OLIG2 (1 products)

Catalog No. Species Pres. Purity   Source  

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn