TA331141 OLIG2 antibody

Rabbit Polyclonal Anti-OLIG2 Antibody

See related secondary antibodies

Search for all "OLIG2"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat OLIG2

TA331141

More Views

  • TA331141

Product Description for OLIG2

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat OLIG2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for OLIG2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BHLHB1, Class B basic helix-loop-helix protein 1, OLIG2, Oligo2, Oligodendrocyte transcription factor 2, PRKCBP2, Protein kinase C-binding protein 2, Protein kinase C-binding protein RACK17, RACK17, bHLHB1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13516
Immunogen:
The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE.
GeneID:
10215
Application WB
IHC
Background OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OLIG2 (3 products)

Catalog No. Species Pres. Purity   Source  

OLIG2

OLIG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OLIG2 (1 products)

Catalog No. Species Pres. Purity   Source  

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn