TA342697 Olr1087 antibody

Rabbit Polyclonal Anti-Olr1087 Antibody

See related secondary antibodies

Search for all "Olr1087"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Rat Olr1087

Product Description for Olr1087

Rabbit anti Bovine, Equine, Human, Mouse, Rat Olr1087.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olr1087

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-Olr1087 antibody is: synthetic peptide directed towards the C-terminal region of Rat Olr1087. Synthetic peptide located within the following region: FYGTIFTGYLLPASPSSSQKDKAAALMFGVVIPTLNPFIYSLRNKDMKAA.
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 455% sucrose.

Accessory Products

  • LinkedIn