H00005956-B01P OPN1LW antibody

See related secondary antibodies

Search for all "OPN1LW"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human OPN1LW

H00005956-B01P

Product Description for OPN1LW

Mouse anti Human OPN1LW.
Product is tested for Western blot / Immunoblot.

Properties for OPN1LW

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms CBBM, CBP, RCP
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P04000
Immunogen:
OPN1LW (AAI56644.1, 1 a.a. ~ 364 a.a) full-length human protein.
AA Sequence:
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVTASVFTNGLVLA ATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERW LVVCKPFGNVRFDAKLAIVGIAFSWIWSAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCC IIPLAIIMLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVCWGPYTFFACFAAANPGYAFHPLMA ALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVSPA
GeneID:
5956
Add. information Mouse polyclonal antibody raised against a full-length human OPN1LW protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for OPN1LW (1 products)

Catalog No. Species Pres. Purity   Source  

OPN1LW

OPN1LW Human
2 µg / €450.00
  Abnova Taiwan Corp.
  • LinkedIn