H00119772-B01P OR52M1 antibody

See related secondary antibodies

Search for all "OR52M1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human OR52M1

H00119772-B01P

Product Description for OR52M1

Mouse anti Human OR52M1.
Product is tested for Western blot / Immunoblot.

Properties for OR52M1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms OR11-11, OR52M1P, OR52M3P
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NGK5
Immunogen:
OR52M1 (AAI46425.1, 1 a.a. ~ 317 a.a) full-length human protein.
AA Sequence:
MLTFHNVCSVPSSFWLTGIPGLESLHVWLSIPFGSMYLVAVVGNVTILAVVKIERSLHQPMYFFLCMLAAIDLVLS TSTIPKLLGIFWFGACDIGLDACLGQMFLIHCFATVESGIFLAMAFDRYVAICNPLRHSMVLTYTVVGRLGLVSLL RGVLYIGPLPLMIRLRLPLYKTHVISHSYCEHMAVVALTCGDSRVNNVYGLSIGFLVLILDSVAIAASYVMIFRAV MGLATPEARLKTLGTCASHLCAILIFYVPIAVSSLIHRFGQCVPPPVHTLLANFYLLIPPILNPIVYAVRTKQIRE SLLQIPRIEMKIR
GeneID:
119772
Add. information Mouse polyclonal antibody raised against a full-length human OR52M1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn