H00081050-B01P OR5AC2 antibody

See related secondary antibodies

Search for all "OR5AC2"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human OR5AC2

H00081050-B01P

Product Description for OR5AC2

Mouse anti Human OR5AC2.
Product is tested for Western blot / Immunoblot.

Properties for OR5AC2

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms HSA1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZP5
Immunogen:
OR5AC2 (AAI53190.1, 1 a.a. ~ 309 a.a) full-length human protein.
AA Sequence:
MDISEGNKTLVTEFVLTGLTDRPWLHVLFFVVFLVVYLITMVGNLGLIVLIWNDPHLHMPMYLFLGGLAFSDACTS TSITPRMLVNFLDKTAMISLAECITQFYFFASSATTECFLLVMMAYDRYVAICNPLLYPVMMSNKLSAQLLSISYV IGFLHPLVHVSLLLRLTFCRFNIIHYFYCEILQLFKISCNGPSINALMIFIFGAFIQIPTLMTIIISYTRVLFDIL KKKSEKGRSKAFSTCGAHLLSVSLYYGTLIFMYVRPASGLAEDQDKVYSLFYTIIIPLLNPFIYSLRNKKVMHALR RVIRK
GeneID:
81050
Add. information Mouse polyclonal antibody raised against a full-length human OR5AC2 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for OR5AC2 (1 products)

Catalog No. Species Pres. Purity   Source  

OR5AC2 overexpression lysate

OR5AC2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn