TA339618 OSAP antibody

Rabbit Polyclonal Anti-MGARP Antibody

See related secondary antibodies

Search for all "OSAP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human OSAP

Product Description for OSAP

Rabbit anti Human OSAP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OSAP

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms C4orf49, Corneal endothelium specific protein 1, GS3582, Ovary-specific acidic protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-MGARP antibody is: synthetic peptide directed towards the C-terminal region of Human MGARP. Synthetic peptide located within the following region: EAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEA.
Application WB
Background MGARP plays a role in the trafficking of mitochondria along microtubules. It regulates the kinesin-mediated axol transport of mitochondria to nerve termils along microtubules during hypoxia. It participates in the translocation of TRAK2/GRIF1 from the cytoplasm to the mitochondrion. It also plays a role in steroidogenesis through maintence of mitochondrial abundance and morphology.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn