NBP1-55151 OSBPL3 antibody

See related secondary antibodies

Search for all "OSBPL3"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat OSBPL3

Product Description for OSBPL3

Rabbit anti Canine, Human, Mouse, Rat OSBPL3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for OSBPL3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp667P1518, KIAA0704, MGC21526, ORP-3, ORP3, OSBP3
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3. Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE.
Background The specific functin of this protein remains unknown.This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 26031

Accessory Products

  • LinkedIn