discontinued

NBP1-55151 OSBPL3 antibody

See related secondary antibodies

Search for all "OSBPL3"

50 µg / €440.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat OSBPL3

Product Description for OSBPL3

Rabbit anti Canine, Human, Mouse, Rat OSBPL3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for OSBPL3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp667P1518, KIAA0704, MGC21526, ORP-3, ORP3, OSBP3
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4D169
Immunogen:
Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3. Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE.
GeneID:
26031
Background The specific functin of this protein remains unknown.This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 26031

Accessory Products

  • LinkedIn